SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032363m|PACid:19713695 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032363m|PACid:19713695
Domain Number 1 Region: 17-82
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000017
Family F-box domain 0.0065
Further Details:      
 
Weak hits

Sequence:  Si032363m|PACid:19713695
Domain Number - Region: 195-303
Classification Level Classification E-value
Superfamily Kelch motif 0.0235
Family Kelch motif 0.023
Further Details:      
 
Domain Number - Region: 63-133
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0549
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si032363m|PACid:19713695
Sequence length 317
Sequence
MVPTTRAMRARADASADRLPRDALSDALLRLPAREICRLRAVCRPWRALTSDPAFVRAHA
AAHPGPLFVAKFRDDPAHVYVIDAGGTVLKRVAGADGGVHVLRTRLDLACLATDWNRCRV
LNPATGALQVLPQSSAPQHKNRVNLSNPYTFFALGLVASTGEYKVFRMFNRLGFLLGGEQ
LFEVLTINDSSGAADSCWRAMPMPSLFIEASTGGVVGSVVYFFVNRGYNPVTLYSDAGAR
SDYILSFDLEREEWRSGLAGPIGEEIDSGEDFQSKRYRFALAELKGSLVLVYKRRQKSIF
VMDLWFLMDFENGLWEK
Download sequence
Identical sequences K4A0H4
Si032363m|PACid:19713695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]