SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032413m|PACid:19712200 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032413m|PACid:19712200
Domain Number 1 Region: 7-68
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000111
Family F-box domain 0.0069
Further Details:      
 
Weak hits

Sequence:  Si032413m|PACid:19712200
Domain Number - Region: 118-267
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00824
Family Galactose oxidase, central domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032413m|PACid:19712200
Sequence length 355
Sequence
MAPPRQPPELVADIVGEILLLLPPADPASLVRASLVCKLWRRLLSNPAFRRRYRAFHGAP
PLLGFLHDHYAHGAVAEPRFVPTVAPSPIPQPALGCRDWSVIDCRHGRVLFDIFGYRVSL
VVWDAVTGGRHFLPDPPISRLLYGAAVICAVRGCDHLDCHGGPFLVLLTALDVTGSVMQV
QMYSSAAGAWKLSAHQDLRHHVARKPSTLIGDDIYFRLDSASTALLRYDLGKNRLSTIDA
PASHSYEGGFAIMPMVDGSLGFADIRGSELCLWSKNVDTEVSAGWEQRAVIELETLIPES
FNQAYVVGFEEGGDVMFVSNDVGVFTIELNSGRVEKISEPGHYDAVFPFMSYYTK
Download sequence
Identical sequences K4A0M3
Si032413m|PACid:19712200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]