SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032426m|PACid:19711599 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032426m|PACid:19711599
Domain Number 1 Region: 12-75
Classification Level Classification E-value
Superfamily F-box domain 0.0000000676
Family F-box domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si032426m|PACid:19711599
Sequence length 362
Sequence
MDPPPLGPPLMEELVEEVLLRVPPDDPATLVRAAVGCKRWCRLISGATFRRRFRELHPAA
PMLGFLYARRSGTDFVPASSFRPPHAFREDWNAIDARHGRVLATALESFSPTGTRFIVWD
PVTDGAQSLPILEFRPYSWGAAVLCATAGCDHLDCRGGPFLVVVVVTDVSQMRTSAYEYS
SDLGTWSEPITVQHPNDWIMIRLHAHVGNALYFNYGLMILKYELGKRELAFIDLPSEFHA
RHIVLMQAEDGGLGFATIQESKLSLWSRDQAGADGYAGWAQQRVIDLDKLLPVSDCNISV
SPYVYAARPPYVVAVADSVGVIFIGKDDGLFTVHLNSGRAERIVVESNSNFKVVPYVSSC
TP
Download sequence
Identical sequences K4A0N6
Si032426m|PACid:19711599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]