SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032447m|PACid:19710264 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032447m|PACid:19710264
Domain Number 1 Region: 13-69
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000301
Family F-box domain 0.0098
Further Details:      
 
Domain Number 2 Region: 127-350
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000017
Family Galactose oxidase, central domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032447m|PACid:19710264
Sequence length 380
Sequence
MLSQRPTTRGDDGVLPPDALYEILLRVPAGPLCGFRAVCQSWRSLLSDPPFVAAHAARHR
GDPLFAIAVAGGSHGETAEIKLLDTSGRVAKRVAAGPSALLRQMRPHLDLVFIRRLQPFG
VQDVPPLRVLDPATGTVSLLPNDDGVCDRSYVFGRAATSTGGDGEYKVLSLCSCKILTVD
GYHGRHGAWRTAPAPPVDDIETLHTGTVVAKGVVYLLVDNADGGWTMAAFDLEAEQWRPS
LLRGPVAVPSIGDRTQRSLAEVNGRLAAVSSTVSTMDLWLLVGSGEQALWSERCRVLTSS
VPRRREVYAYEEPLWVLDDGRVAFWACSYFARTGALWMYDPRTETCTRVAAMENCPKVGV
GVYTGNLLRQVQRPHGMVLI
Download sequence
Identical sequences K4A0Q7
Si032447m|PACid:19710264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]