SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032466m|PACid:19709803 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032466m|PACid:19709803
Domain Number 1 Region: 10-78
Classification Level Classification E-value
Superfamily F-box domain 0.000000000017
Family F-box domain 0.0068
Further Details:      
 
Weak hits

Sequence:  Si032466m|PACid:19709803
Domain Number - Region: 76-162,208-331
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0017
Family Tricorn protease N-terminal domain 0.032
Further Details:      
 
Domain Number - Region: 245-330
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00366
Family WD40-repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si032466m|PACid:19709803
Sequence length 359
Sequence
MSPTPARPPPALPDDVVEEVLARFPPDDPALLVRTALVCKDWCRLLSGPGFRRRFRRFHR
KPPLLFYIYHCATLIYYKPTSSFRPLHPASPDWNILNARHGRFLVLNVTSPAPSMEAEFI
VWDPTTDEQHRLPMPPFEYTSWNAALLCAAAGCDHSDCPWGPFLVVFVFARSSEEGMMSA
CVYSSELARSLEGADLRSPRRNAIYFGCHIKTGVLEYDLGKQELSMVGLPPLTYWTHFVL
MTAEDGGLGFASVQGSKLCLWSRVAGGPGGSATWVQQRAIELDNVLPVRDPSMSPNVYTV
AVAGELGVVFIWADGELFTIDLRSGQIEKVGNGISGSGFVPYTNFYTPGTETSHHPFYP
Download sequence
Identical sequences K4A0S5
Si032466m|PACid:19709803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]