SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032495m|PACid:19709196 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032495m|PACid:19709196
Domain Number 1 Region: 35-90
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000249
Family F-box domain 0.0058
Further Details:      
 
Weak hits

Sequence:  Si032495m|PACid:19709196
Domain Number - Region: 345-464
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.00379
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si032495m|PACid:19709196
Sequence length 488
Sequence
MALQATEQGSRPPASDADTDPARRPLGPGGMGGSKRAAVAGLPDDALVEILSRLPAKFLC
RSKCVSKAWCDLIADRLRCRKLPLTLEGFFYGCVYESCNEDRDDLSSDSWDESGSEGNDD
DGSEDDKEGGSANNGKGGSEDGDEGGECKGEKSSCHACGHFINLLGRSVPLVDPSFSVLR
KQPGIKNFTLLDSCNGLLLFGQAWCSRFSATTSYIVYNPATEHWVPVPSSGFSSNPLEYG
EDCDDDVEESCVLTCLIFDPAISSHFQLIEFCHNPGVALVLAYSSETERWGDRPRERRRW
KKGGKWDLHKTMSSMRGSTFFNKMLHLIVSPYSIGPELIAAIDGKGKTRKVIQWVENRGF
PVFVGQSKGLLHCLSVSGHPDGDSCHMTELSIWVLEDYDAEEWNLKHTVSFLELFGKKSC
QFGSDYNVTTIHPDQNLVFFIQHWDYKLISYDMDRKEVCALRTVGCDYGIITPYAPYFSE
TPVLSKKH
Download sequence
Identical sequences K4A0V4
Si032495m|PACid:19709196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]