SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032499m|PACid:19710570 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032499m|PACid:19710570
Domain Number 1 Region: 114-233,279-407
Classification Level Classification E-value
Superfamily RNI-like 1.37e-36
Family 28-residue LRR 0.0059
Further Details:      
 
Domain Number 2 Region: 8-55
Classification Level Classification E-value
Superfamily F-box domain 0.00000000102
Family F-box domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si032499m|PACid:19710570
Sequence length 506
Sequence
LPSPPPPQLLASIAEAAGEDRTADLPEDLLALIFGLLGSRERKRCSLVCRRWLAAEAASR
LRLALDARAPLLADSALPRLLARFPAVSKLALKCDRRAESVGDPALALVADRLGPGLRRL
KLRSLRAVTDDGVAALAAAAANLRKLSVGSCAFGAKGIEAVLRCCLQLEELSIKRLRGLA
DSEPIAVSGPRLQSLSLKDLYNGQCFSCLITQSPNLKTLKIIRCSGDWDLVLQDVPKDSI
LSELHLEKLQVSDRGVAALYGLEVLYLAKAPEVTDVGLAALAAKSPRLRKLHVDGWKANR
IGDRGLAAVAQKCASLQELVLIGVNLTYSSLELIAANCPTLERLALCGSDTFGDAEISCV
AAKCAALRKLCIKACPVSDVGMDKLAEGCPRLVKVKVKKCRRVTSECAERLRASRNGALA
VNFDTPGGAGELQDARSIDESGVLDNAGSDVPPEDLDDRIGPDISSGSSGRPSRWKARMG
ALMPRSLSVSIFRRQSHGASYTSHES
Download sequence
Identical sequences K4A0V8
Si032499m|PACid:19710570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]