SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032503m|PACid:19711978 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032503m|PACid:19711978
Domain Number 1 Region: 12-59
Classification Level Classification E-value
Superfamily F-box domain 0.000000474
Family F-box domain 0.0093
Further Details:      
 
Weak hits

Sequence:  Si032503m|PACid:19711978
Domain Number - Region: 150-262
Classification Level Classification E-value
Superfamily L domain-like 0.00714
Family Ngr ectodomain-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032503m|PACid:19711978
Sequence length 294
Sequence
MGTDHGDLVGAGEDRISGLPDHLLHRILLGHPDLSTFDAARTSVLSRQWRRVWADLPDLS
FSYSGEPGSYARTHDRIDTALDAYSAPAAKCLRISVPLSWTCRVPVNRVASWLRFASRRL
AGELRLSLRFGKRKNEEEELVIPLCERATAIRFMDLGCTLRFRLPPVVGAFAALATLGIR
DASLDGRELDDILSSRCPRLKELVLEGIILPDGDAAVLSIRSNSLEYLKSPTAAAPKLKD
VYCYNNDYGYDPSRHRFVEAGKHLRRLAIKASDAALMRQFNAVDELVLDVYLPK
Download sequence
Identical sequences K4A0W2
Si032503m|PACid:19711978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]