SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032587m|PACid:19714192 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032587m|PACid:19714192
Domain Number 1 Region: 60-117
Classification Level Classification E-value
Superfamily F-box domain 7.19e-17
Family F-box domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si032587m|PACid:19714192
Sequence length 317
Sequence
MEVRGEDGAACGARRGLLGLESQFESDAEGNGRADGMEMGRARMSATGGGSVCRAVPEKR
IVPTASGIGVLPLDAVYEILLRLPADELCRLRLVCRSWQSLTSDPGFTRAHASRHPLLAG
VHIACRTGDEIRIVDLFSGDIVRRIVPTVQPRYGMNAQLDLVCVSAMSTHQPNSVLNLAT
GEVVATFLPNASGRDNDIISPLLLGHIPSTGEFKVFYYSHLLGEDGAHGMVQTCCVATLV
GGRGGRRWRATPSPPAVLGSCLRDSVVVGGVAYILFSPLYNQRNNHANLEPDAMALFDMA
VEETGAASGATEQPSRR
Download sequence
Identical sequences K4A145
Si032587m|PACid:19714192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]