SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032591m|PACid:19713530 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032591m|PACid:19713530
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000471
Family F-box domain 0.0085
Further Details:      
 
Weak hits

Sequence:  Si032591m|PACid:19713530
Domain Number - Region: 51-239
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.00889
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032591m|PACid:19713530
Sequence length 272
Sequence
MLPDDAVGEILRRLPPDEPACLVRASLVCKSWRLLISEPDFLLRYHELHPTPLWLGFNCH
HDRVLLHTMDPTCLVVWDPITNDKHFLPEVLDYPCNHLIAAVLCAANGCNHSGCHGAPFL
VWSTLAWIHLGLISKSRDVIEPGLLIGNTLYFLLEDGRRVLKYDLGGHHLSVMNTLPLSG
GCRMGTGMIIELDMMLSMDTGDPSTKLLVVGFSEGVNTIFITANAGIFAVDLKSDQVKKI
CGSGASDTIIPYASFYTPDFAGGRLQPPVRMQ
Download sequence
Identical sequences K4A149
Si032591m|PACid:19713530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]