SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032609m|PACid:19709936 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032609m|PACid:19709936
Domain Number 1 Region: 9-54
Classification Level Classification E-value
Superfamily F-box domain 0.0000000759
Family F-box domain 0.008
Further Details:      
 
Domain Number 2 Region: 158-265
Classification Level Classification E-value
Superfamily RNI-like 0.00000691
Family 28-residue LRR 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032609m|PACid:19709936
Sequence length 382
Sequence
MARSSRSATKKPKAAAADRFTALPLELRAQIASFLPYPQVAQLAVLSRPWRHIHLHTPVV
DLNLDEFLYFAGAIVDDRTSLRGLLDDDALLGVRHALLRRAKEGSSVDVLRLVYSAGDPR
VRRHADRIIALADASDVVLSVPFFGARPSRATAAAWALDVPPSTRYLELNWNDYLAPAIA
GPGAAALRELCLENLELRRWPRLPSLRTLTLSTVNVKGPFAPAACYPLLEDLCMCHTNIE
HARVDIRLPALKSLDMDDVDVSVPGDHDGSGPCCGDITVDAPMLEAVELKGTAEWTVEYK
SFTLRAPRLRCLSWYGHRDMKYFRAQMLQMLQGLLPDLPPETVANVARPYMTVDAYTVEA
EGTGEMIPEERLTCNLTALMST
Download sequence
Identical sequences K4A167
Si032609m|PACid:19709936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]