SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032644m|PACid:19713440 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032644m|PACid:19713440
Domain Number 1 Region: 18-84
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000144
Family F-box domain 0.0045
Further Details:      
 
Weak hits

Sequence:  Si032644m|PACid:19713440
Domain Number - Region: 61-167
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00634
Family SGL-like 0.049
Further Details:      
 
Domain Number - Region: 203-264
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0895
Family Quinoprotein alcohol dehydrogenase-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032644m|PACid:19713440
Sequence length 327
Sequence
MSPPTTRAMRARAAASSDRIPPDVLFDVLLCLPARDLCRLRAVCRSWCDLTAGDPLFVTA
HAAHHPGPLFLAKFRDDKASIYVVDLSGSVVKRIPGAGGGPSHRLLCTRLNLACVATDWN
RCSVLNPATGAVQVLPEILAEEHINRVNLSNPYTFFALGRVAATGEHKVLRMFNRLGFYN
GGQQLFEVFTVSGGDGDARWRGRQGPGLFIDECSGTVIDGVVYFLTNKVYDGARCGIRPD
YIVSFDLGKEEWRRDLRGPISSNVEHAKVVLYLRRDLSLADLKGSLVLADQRDQPFTMDI
WFLSNFQNGLWVKEYHIRTESIISRLG
Download sequence
Identical sequences K4A1A1
Si032644m|PACid:19713440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]