SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032651m|PACid:19709866 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032651m|PACid:19709866
Domain Number 1 Region: 10-72
Classification Level Classification E-value
Superfamily F-box domain 0.000000235
Family F-box domain 0.012
Further Details:      
 
Weak hits

Sequence:  Si032651m|PACid:19709866
Domain Number - Region: 273-341
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.00458
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032651m|PACid:19709866
Sequence length 362
Sequence
MDSPKTKRGEVADAILSRLPAKPLFRFKCVSKGWCDLIAGRLGRRKFPQTLEGFFFGGGG
DGGGVNYGHFINLSGRSVPLVDASFSFLTKLPGIKNIDLLSAHNGLLLFEHFRDRHRYEY
IVCNPATEQWVSVPSSGITPYPPVEGNYYSLTLAHNLLIFDPAVSSHFHLLQFRNLCWFE
TVQVQAVRVFSSETGVWRDIKGEGEDKIQSKLGWANVNGMLHIPVYKHYLQSQQKDIIAV
VDLQGKKNMAIHWPDMNEFAAPVFIVHIIELSIWVLEDYGAAQWVLKQSVSCLQLFGEIS
CGVDDLDVVAIHPDRNLVFFVHRYNWKLVSYDMDSEDEVYDLCTLGHGGGLIIPYVPYFA
ER
Download sequence
Identical sequences K4A1A8
Si032651m|PACid:19709866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]