SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032654m|PACid:19709371 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032654m|PACid:19709371
Domain Number 1 Region: 20-80
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000876
Family F-box domain 0.0079
Further Details:      
 
Domain Number 2 Region: 177-305
Classification Level Classification E-value
Superfamily RNI-like 0.0000439
Family Cyclin A/CDK2-associated p19, Skp2 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si032654m|PACid:19709371
Sequence length 337
Sequence
MELSGGDSEGAPKRAKLSSGDAGGGEDCLSALPDDVLVLILLRLDTTVAARTSVLSRRWR
RVWALLPKLCFPVAPEPHRFRDTLDTHEEPLRDLLVGAGGATPESLAIWLPAAARRVSGD
LTLLTFDPGKDAGEEEGEAAQRGAFELPCFEKATSISLILGFHGLAIAMPPTGVFARLTG
IYLSCVRFHGPCTLGDAMSSPRCPCLQRLTVDDSRGLGDLTINSVSLLQMELRNLRGLWQ
VTVVAPALTELTVIYCFRNDDTQPVANISAPQLVSLEWKDAYDPSSVHLGKMAHLRWLGT
FYLVYGQDRLSHNHSCSTLLQRFEAIETLFLTLAYMR
Download sequence
Identical sequences K4A1B1
Si032654m|PACid:19709371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]