SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032683m|PACid:19713948 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032683m|PACid:19713948
Domain Number 1 Region: 18-86
Classification Level Classification E-value
Superfamily F-box domain 6.67e-16
Family F-box domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si032683m|PACid:19713948
Sequence length 171
Sequence
IRRSLPSPMAPPPNPRSRASVRPLPLDALYEVLLRVPAKDLCRLRAVCRPWRSLLSDPHF
VAAHTARHPEPLIVAATHHTDRSPPDHLLDIMDLSGRVIKRVVKSGSFWAARFAEDHSPQ
VPDISDYCQLVAVGKVASTGEYKVLRVLRGYFPQHHEQLCEVFNLDGSSNA
Download sequence
Identical sequences K4A1E0
Si032683m|PACid:19713948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]