SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032684m|PACid:19711918 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032684m|PACid:19711918
Domain Number 1 Region: 25-79
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000126
Family F-box domain 0.0073
Further Details:      
 
Domain Number 2 Region: 209-380
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00000562
Family Galactose oxidase, central domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si032684m|PACid:19711918
Sequence length 388
Sequence
MASSKLCAGQVVAETRAILTLAGGDLPPDAVFEILLRLPGRDLCRLRAVCRPWRSLLSDP
AFAAAHADRHAEPLVVAGYAKHTSNNGVLYDILDLSGRVVRRVHAAATTPTENEWVASTG
PGLVCVAAAGVAFALPRGLAEDHAAHERDISHHTAMVALGQVGSTGERKVLRVLHLFPDM
ARQLYEIITLDGGDRCRWRKAMDPAHTVGLGTWTAIDGVVYFFSSEFIQGQDVMPDRIAS
FDLETEEWRPTIRGPVSSSLADDVGGHPINHLDWGEFSLAAMNGCLVMTHRVFSSSMDLW
FLMDVEKGLWVKKHVLQLSISYQHGEHAVRPLLVLDDGRIVLVHIGNRGSLKIYDPRTSS
STDVAVLGPCVAVGLFAGSVLSLANGDS
Download sequence
Identical sequences K4A1E1
Si032684m|PACid:19711918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]