SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032690m|PACid:19709208 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032690m|PACid:19709208
Domain Number 1 Region: 10-76
Classification Level Classification E-value
Superfamily F-box domain 0.000000000017
Family F-box domain 0.0067
Further Details:      
 
Weak hits

Sequence:  Si032690m|PACid:19709208
Domain Number - Region: 68-199
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00942
Family Methylamine dehydrogenase, H-chain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032690m|PACid:19709208
Sequence length 321
Sequence
MRERAAASADRIPTDALFDALLQLPVKGLCRIRAVCRPWRGLISDPVFIAAHGARHPGPL
FLAKFQDDKMSIYVVDLSGGVVKRIAGAGSGPYHQLLCTRLDLACVATDWNRCSVVNPAT
GAVHVLPETSAPEHWNRVNQSNPYTLFALGRVAATGEHKVLRMFNRLGYRNGGQQVFEVF
TVSSGGDGHARRWRGHQGPGLFIDECNGTVVNGVVYFLTYSDYDGSHHGIRPDYILSFDL
GVEEWRRDLRGTISSNAGDDEVPIFNRRQLALAELNGYLVLAYHNQQPRTVDLWFLVDFG
SGLWMKQYHIQTGSLILRPPH
Download sequence
Identical sequences K4A1E7
Si032690m|PACid:19709208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]