SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032713m|PACid:19710630 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si032713m|PACid:19710630
Domain Number - Region: 5-63
Classification Level Classification E-value
Superfamily F-box domain 0.0366
Family F-box domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si032713m|PACid:19710630
Sequence length 214
Sequence
MASGRKCLLLTDLPMEALIIIADDIVASSFKPMEDLGNLGAVCRVMERACGNPSNGQRVV
MLRIYMEGLEWLDPDRYYNLLALLVDVANPQACTLKGIADFFIGTDPSLNELSRAAVGGH
NVGGPSMYIRCLECEDDSVAVGSAGPNKLPNDGCRVCREKAAYIVNSVTWRMHGEMLPPA
PVRGDFPCARGDCGKVKGWEQATLFCNEDCMICH
Download sequence
Identical sequences K4A1H0
Si032713m|PACid:19710630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]