SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032718m|PACid:19712344 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032718m|PACid:19712344
Domain Number 1 Region: 4-57,90-120
Classification Level Classification E-value
Superfamily F-box domain 6.67e-17
Family F-box domain 0.0046
Further Details:      
 
Domain Number 2 Region: 208-359
Classification Level Classification E-value
Superfamily YWTD domain 0.0000994
Family YWTD domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032718m|PACid:19712344
Sequence length 386
Sequence
MEQGTTPATYLPDELVVEILARLPAKSLCRFKCVSHRWRRLISDPVHRARFVQTLSGFFF
LSDEGPRFRFAALPSSVTPLEEDGDGPPLVDAALSFLPPRCGKIEMLDSCNGLLLLRCYN
ELSSSPPPPFYVVCNPATREWVALPQPRYNGYGQGARTWYAAVGFDPAISSHFYVFQVVE
VDDGMTRCSIAAVEVYSSETGTWVLRECKPEWIDFYGRMTYFNGSLHLPIEHEEVVSVDP
NGQSWKVTQVRHCEDHGHREGRGYVGHCRGRLIYANNDRKYDVLSIYVREDQASREWIMK
HNVSKSDLLFEPWKHMLKPTYYIAGFHPDGDLVFFYDRTRNMLISYDMNHGDWHVVCTLE
DFKHAHHPFFPYVPWYSRGLASPNIN
Download sequence
Identical sequences K4A1H5
Si032718m|PACid:19712344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]