SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032729m|PACid:19712143 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032729m|PACid:19712143
Domain Number 1 Region: 21-70
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000144
Family F-box domain 0.0066
Further Details:      
 
Domain Number 2 Region: 193-361
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00000719
Family Galactose oxidase, central domain 0.041
Further Details:      
 
Weak hits

Sequence:  Si032729m|PACid:19712143
Domain Number - Region: 74-221,338-351
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00212
Family Quinoprotein alcohol dehydrogenase-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si032729m|PACid:19712143
Sequence length 388
Sequence
MGSAVIRQKKPALALAADSGTLPLDVLFEVLLRFPANVLCRLRLVCRSWRSLTSDPVFAR
AHASRHPLLASIHIGRLSHEVRVVDLSGSIVKRVPVTRPSYALNTQLDMVCVSGTFSRSQ
GYVLNLATGEVVAAYASLLRDEHGGEALISPFLLGHVPSTGEVKVFYSHTRAVHGEEGDF
AVQVCSITTLGDDGDCGRWRVTPSPPANVASSTRDRVVIGGVAYFLLSMRCTANVEPDAI
AVFDLVTEEWRPATLRGPLSSRLTSDDEELVYHRYRYGVQLAAVDGCLVTVHNNDHCQGS
SMDLWFLVERGLWTKRYSIQSASCYDAFTHSYPLLLLDDGKIIIWDDETQVLRAYDPRAN
KLADLATLRNYFFMNMYQGNLLCPGLQR
Download sequence
Identical sequences K4A1I6
Si032729m|PACid:19712143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]