SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032730m|PACid:19709973 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si032730m|PACid:19709973
Domain Number - Region: 128-299
Classification Level Classification E-value
Superfamily NHL repeat 0.000149
Family NHL repeat 0.023
Further Details:      
 
Domain Number - Region: 12-65
Classification Level Classification E-value
Superfamily F-box domain 0.00157
Family F-box domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032730m|PACid:19709973
Sequence length 386
Sequence
MPCTLSTQRGARPAEETAAKHGWSSLPDDLVIQVGNRLLADSDIYSYMDFRAVCTSWSSA
TKDNAKPGRFQPSKWALIDRHDDVLTFVSVETGRFVVKNIPLLRRYGFVGATGGGMIILE
EPVPPYQVRVLNPFTGLFLRFKASLPIIGWVREATLTTSPVMLFVSSEVGKIMWADLDSE
HFQQFGVDSRNTPLSMTPFDGKLYLSDQEGSILSSTVPSGSAQTLSMATTIPSAVGGHPA
WYCYLVKSGEELLLVSRPWYEIHGKPVVRKVDTENNKLEVVTSIGNRALYLSDVRCLSVD
ASKFQGIEGGCIYFVDPVSTAGNGQASLMTTFRVAEQVQDDIIFDVATMAGGSRQPFTLA
QVFANYCSDEEFSYDDSESDGVSSKI
Download sequence
Identical sequences K4A1I7
Si032730m|PACid:19709973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]