SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032798m|PACid:19711742 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032798m|PACid:19711742
Domain Number 1 Region: 45-117
Classification Level Classification E-value
Superfamily F-box domain 0.000000314
Family F-box domain 0.0074
Further Details:      
 
Domain Number 2 Region: 158-335
Classification Level Classification E-value
Superfamily L domain-like 0.00000408
Family Ngr ectodomain-like 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032798m|PACid:19711742
Sequence length 448
Sequence
MFATFGWHSTYMFPKLAHEAYKGQMDIITFVWRKPDISSCLFAESSCWFNLPIEDILLHI
HSLLPLRDAARAASVSRAFQNSWRCHPNLYFSMKTLGLNATLHGHDKTEDKFIKIIYHIL
KMHSGSGLKTFGLEIYGHYNSCHLNSWLHLALTSGLEELILKLGMPNYNFPCSLLPGKSR
DSIRNLCLSFCTFRPTARLSLRSLKKLYLNSFALERLELLHCSDIFHLKIPYLLRRLSHL
DVKACHSLKVTEIKAPNLSTFLFKGNDIVQHSLGEACQVTNLYMSCYDAIHFARVDLPLI
APNLEILTIESPSEEVSNIAILPSTFHNLKYLDICVPGEFVVPDYDYFSLVSFLDASPFL
ETFILDIYLPTVFEDPESVLGEASHMRRMAEVHHSNLKRVKITNFHPTKCLKSYSKSGKC
FILAVGAYIKGKVPSTARLDFPKPCTSD
Download sequence
Identical sequences K4A1Q4
Si032798m|PACid:19711742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]