SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032806m|PACid:19713090 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032806m|PACid:19713090
Domain Number 1 Region: 26-87
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000471
Family F-box domain 0.0061
Further Details:      
 
Weak hits

Sequence:  Si032806m|PACid:19713090
Domain Number - Region: 86-216,341-379
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0228
Family Quinoprotein alcohol dehydrogenase-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si032806m|PACid:19713090
Sequence length 406
Sequence
MASPGPSSPPDSRSTRRRTPVASNTGVLPPDVLFDVLLRLPAKELCRLRAVCRAWRSLTV
DPLFTGAHAARHPLFLANFRDDQTHICVVDLLGIVVKRIPNADGHLLLHTSLDLACATTV
RNSCQVLDPATGNVHVPPESPAVEHLDRENVRMPYTSFAFGRIATTGEYKVIRIFNRPTL
AGFHQPHLFEVFTINISGSSSGSSHTQWRARQPDHFFDPSSAIVVGEVVYFKVDIVFDVL
ICGDVYPGIPLDCILSFDLEREEWRGILNGPISEIFETDKYAGDLDGYRGLWTQVTLADL
RGSLGLVHYRKHRHMMDLWVRKDIDGGLWVKEYIIQIEPIFPTTESCVKSLFMLDDGRLV
IHFPKTGLLFIYDPRTNTSAQVEMRHLDAVAMYTGNLLSLQVGDMV
Download sequence
Identical sequences K4A1R2
XP_004955930.1.39314 XP_004955931.1.39314 Si032806m|PACid:19713090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]