SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032828m|PACid:19713869 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032828m|PACid:19713869
Domain Number 1 Region: 10-81
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000183
Family F-box domain 0.0075
Further Details:      
 
Weak hits

Sequence:  Si032828m|PACid:19713869
Domain Number - Region: 106-226
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00129
Family Galactose oxidase, central domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si032828m|PACid:19713869
Sequence length 291
Sequence
MSPPQRRSPVPPDLMDEILGEILLRIPPEEPAHLIRFALVCKPWLRVLSDPAFRRGYRER
HRRPPLLGFVHNLYENGPIPRFVPTTASRCSSPVFNCQNWWALDSRHGRVLVNRFEPSDL
VVWDPVSGDQQHLPLPPYSHAYDTGAQRPILVVFVGTDDEEAVTWASMYSSETRGWSAIA
TADFSASTMVDLHSYIETKPSILIGNALYFSVELGKAILKYDLAGQGLSVIDAPEVSKQM
RILMAVEDGGLGFAAIEAGVFTIEIKSEKIKKVGKRGGCYAVLPYMSFCAP
Download sequence
Identical sequences K4A1T3
Si032828m|PACid:19713869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]