SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032857m|PACid:19714115 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032857m|PACid:19714115
Domain Number 1 Region: 1-50
Classification Level Classification E-value
Superfamily F-box domain 0.0000000288
Family F-box domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si032857m|PACid:19714115
Sequence length 395
Sequence
IPDDVLELILLHLASPVNLIRAATTCKRWHGIVAGARFLRRFGSLNGRHLVAGSYHNSRF
LDSSELEPEPEHQAPAFVGSYHNGRFLDSSEPEPEPEYAPPAFVASSPPAAGGVDGERFS
LDFLWEPDEVVDPYFWRIKDSRGGLLLWALEERYDFSPTWSLHVVVCDPLARRYRAIPPL
VKPDRYHIHSGPFLLDGDVAPCSPHRDRGSWRGYSVDGQRMRLFMGRTRASLYWQGEGKT
VTALDRSTAELSCSELPGTEDWDGRSTALRVAAGRDGEARVLTTWPGGVLKVFALPRGDG
EWAHEKTIDLSAVARGLPGYRPTYFSGEVASWTNVTDTALVVLWWREESWAFRLDIEAVE
AELVPIDGFCDVAFPCELPWPPVLRRRARKLPAGV
Download sequence
Identical sequences K4A1W1
Si032857m|PACid:19714115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]