SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032867m|PACid:19709405 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032867m|PACid:19709405
Domain Number 1 Region: 36-94
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000667
Family F-box domain 0.0078
Further Details:      
 
Domain Number 2 Region: 141-360
Classification Level Classification E-value
Superfamily RNI-like 0.00001
Family Rna1p (RanGAP1), N-terminal domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si032867m|PACid:19709405
Sequence length 482
Sequence
MEAREIVSLVEQSLPPADHVVTMAAALSVDEASDGEDRISDLPDDLRRKIVSRLPIKDAV
RTSALSTHWRHFWRSVPLVLCDAHIPRTKHFSPYTAITSVLTQHPGPFRAVHLSRWSMRM
YPNLQQVEWARLLAEKGVEDLTFVNFPNWQRLAADASLRLPIDILRCTKISRLRLGFWTF
PGTTVADLPRGPNVFPNLLELGLHHIAIDTECIDYMMECSPELKVFTIVANTNGRASIKI
RSQNVVQVVFWASISKDLDVRGAPSLDRLILWNGSSVGMFCSLINLSLASTLRVVGYLEP
RIHKLKVADIVIKAGTRPSPLTVIPSVKILALKLRFAVRKEAEMFLSFMRCFPNVETLHI
VSDEADRCKGKQTLQFWRNADPVECTRSQVKEIVFNNFRGYNSELSFLQFVLESAHVLKK
MRIVLAGGEPNHNTELVNKLKPLDSARHAIEDVLLEIVEGDGGDVWCFRQASDPFVIDPF
SY
Download sequence
Identical sequences K4A1X1
Si032867m|PACid:19709405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]