SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032876m|PACid:19710967 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032876m|PACid:19710967
Domain Number 1 Region: 9-84
Classification Level Classification E-value
Superfamily F-box domain 0.00000876
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si032876m|PACid:19710967
Sequence length 405
Sequence
MADATPRARQPPSWANIPRDLAGMVLRLLPARADRARFAAVCSQWCAAARQLPLPPPLPL
LALPDGTFYSLPHCQRFRFPGFGCAGYKSACCGRWLVFPRDDGCFLVDPFAGATVALPPL
SRVRLRPPNATAKYVQLPGVSMFYPYATWMHIQDPKKMPVINKIIMCSPNLVAAFAGSTL
TGAGQNSQIIVCQPGASSWSVRAKDPCKLFEDMAFYQGKLYALANDENLLIVSISQDPTT
GDPQISRFGQVISGDPWYSTIMPGDATGKKKLYLVESGGSLLMVRRKVCCRLEGETVMAE
QSEFEVFKADFEHSRWVNVTTLGNDQMLFLGRPCSRVMSASQYGVPGDQIFFLDDVLENY
CKEYSFDEETTSVSVYNMKSGKVSSPLPMVWKHEMILATWLFPWD
Download sequence
Identical sequences K4A1Y0
Si032876m|PACid:19710967 XP_004959674.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]