SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032882m|PACid:19711167 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032882m|PACid:19711167
Domain Number 1 Region: 5-68
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000563
Family F-box domain 0.01
Further Details:      
 
Domain Number 2 Region: 165-343
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00000131
Family Galactose oxidase, central domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si032882m|PACid:19711167
Sequence length 370
Sequence
MDNVNEILLRLPAKDLCRLRAVSRSWWSFLSKPQFMADHAARHPEPLIVAGYNTYHREDR
ILYDICDLSGRIVKRVHATREEWVLYGQPDLLCVVDWTNMSVKLLNPATGVAYVLPTEFA
EEHAAYHQYLYKYSFSATFGQVASTGVYKVIRVIFVLDGGHFEQLYEVFTLDGNIHAQWR
AKQAPPYQVEMDHWDNVVINGIVYFFLSYNVDEDKRRIGSFNLETEEWSPSIPGPLSSLM
DAAADHIDCSFQLTIGALSGSLVIACHPATSTHSSMDLWFLVDFEKGLWVKQYSIELSFR
HPAYAIHPFLVLNDGRIVFVIDTINSGGLLSIYNPETKTSEDVMEMGYGVAVGLYTGSAL
SLANKVPVSE
Download sequence
Identical sequences K4A1Y6
Si032882m|PACid:19711167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]