SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032921m|PACid:19713999 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032921m|PACid:19713999
Domain Number 1 Region: 130-331
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000000419
Family 28-residue LRR 0.032
Further Details:      
 
Domain Number 2 Region: 14-67
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000366
Family F-box domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032921m|PACid:19713999
Sequence length 389
Sequence
MAPRRPRKKRRIPGATATPAPASDALLSLPPEVLDEILTRLDLRDAVRTSALCRAWRRRW
ESLPSLDISTPFGEQPLWTVDCVLPRCSGRVRRFHASLDELSARRLDDWLLILSHRGGVE
DLELSPPYPYKFFSLHSTIFSWRRLISIDLFACDIPLLPQDFEGFPDLKVLSLANVKLQQ
KGEYQLEEIIETSPLLEKLILSEVCIGGDDFIEWEIQAHNLRHITICSNIDYGWNFAELP
CLHSAVIDLWEYVGGRDFAKFLAGLVQVRKLSLCTFYAPVNGIKILETLPCTFNNLKSLK
LFMHFCELPPILLVICFLRSVPNLEKLKIRIYYGKEQKVEANGEFLNAQWADGMCANLQI
LKMTVSHVDPLHELVTYKSTSAQAQVLFK
Download sequence
Identical sequences K4A224
Si032921m|PACid:19713999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]