SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032939m|PACid:19712479 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032939m|PACid:19712479
Domain Number 1 Region: 4-65
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000654
Family F-box domain 0.0086
Further Details:      
 
Domain Number 2 Region: 91-368
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0000000589
Family DPP6 N-terminal domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si032939m|PACid:19712479
Sequence length 407
Sequence
MERPKKSGAVAGLPDDPLVEVLSRVPAKDLHRSKCVSKGWRDLIADPLHRKKLPRTLQGF
FHAWDFINLLGGSRPPVDPSFAFLKKLPGIGNICLRDSCNGLLLFRHATSRTISYVVCNP
ATEQWAAVPSEHTPADYHMRVRNTYLVFDPAVSSHFQLVTICAEEGSLATVHIYSSETGV
WKHSQTDWAEEEKQLGLWKGPNPQINGRVRGAPFFNGLLYVMLNNYQIAKVDVEGKTRGI
IPAPSSMNNLGAYYGPPFIGQSQGHLYCIHEPPSQVYTRDFNDDRDLLSIWVLDYDTQKW
ALKHRVSRTHLFGSRFYTSDCDYNVVAIHPDSNMVFIFLNWKRQLISYSLDSKEVRALGT
LEQDPGWFVPYVPCFLDFLSVVEHEEKLKGPGEQSAEDVARVGGGGQ
Download sequence
Identical sequences K4A242
Si032939m|PACid:19712479 XP_004959027.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]