SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032941m|PACid:19710980 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032941m|PACid:19710980
Domain Number 1 Region: 11-129
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000288
Family F-box domain 0.0057
Further Details:      
 
Weak hits

Sequence:  Si032941m|PACid:19710980
Domain Number - Region: 109-270
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0581
Family Quinohemoprotein amine dehydrogenase B chain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si032941m|PACid:19710980
Sequence length 363
Sequence
MAKPRARAPAPPELMEDAVEEILLRLPPDEPAALVRASLVCKPWRRIVSDPAFLRRYRRF
HPTPPLLGFFNELYGAAPERRFVPTTPASPFPKAAFDRRSWAAVDCRHGRVLLQKEKAGG
NFVVWDPITGDQEELHMPSITGDRATSFYSASVLCAAAGCDHRDCHGGPFLVVYLGNDES
QPIVHACVYSSESGAWVTMVSAHIGYNDFFTAYCGTLISDEIYQVIIGDDDAILKYDLGN
HCLSVIGLPDESDDGGIVPMPTEDGSLGLASISASCLHLWSRKVNEDGIAGWVQCRVVDL
QALLPIDSPCKRAYVIGFAEGVGVIFVTTEVGTFTVELKSGKVKKVSEPRYYFVVPFMTF
GTP
Download sequence
Identical sequences K4A244
Si032941m|PACid:19710980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]