SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032957m|PACid:19709455 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032957m|PACid:19709455
Domain Number 1 Region: 5-98
Classification Level Classification E-value
Superfamily F-box domain 0.00000000144
Family F-box domain 0.0078
Further Details:      
 
Domain Number 2 Region: 104-243
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00000144
Family Galactose oxidase, central domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si032957m|PACid:19709455
Sequence length 364
Sequence
MPPPPLELMEELIEEILLRLPPSDPASLVRAALVSTPWCRIVSGAAFRRRFRAFHRTAPL
LGFLCDPWVYGFRWDGVLVPTSSAFRPREPFAWRRPLDARHGRVLFHDSSSYYHLHVWNP
ITDAWIALPMMPNDDPDRDDWTAAVLCAAAATGECDHLDCHDGPFTVVIVGSGEDDEEMF
SYVYSSESGQWSELTYADYCPDDSLNCQHSMLMGNALYFMFGSSSMILKYDLGTREMTMM
DLPRYDGNDYDASSVSSVQLMTTEGGRRLGFVRLEDTRLCLWSRDDEADVGWAPNRVIEL
EKLLPFDRSLAWRTFLLGFAEGVGVIFLCVGDGVFTVDLKSSKVMKVYEGRISSVVPYMS
FRTP
Download sequence
Identical sequences K4A260
Si032957m|PACid:19709455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]