SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si032987m|PACid:19710893 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si032987m|PACid:19710893
Domain Number 1 Region: 19-98,168-265,292-328
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.000000471
Family Tricorn protease domain 2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si032987m|PACid:19710893
Sequence length 350
Sequence
MAPAAHLAAAAHAAGRSKGDSLLVTAVYNAADTSRVDVKLVDVTSGAIVTHLDKQRSTGH
IATTGGLIFLAPTGSTAASIGVLNPATGAMTDIPTGTPANGGPTSRPAYVFGQVPATGGY
KVLSIDTAGGYGHQPNQSCEILSLGGRWRSAPSPPVLVNMTVSRHRAVTQGFAHFLTTSR
TAAAGDFDGIASFDLAKEEWRPSLLQGPLPSKSRNCCHSNLSLVELNGCLVFVHHDYLSC
CIDLWALTDLEKGTWLRIQSLHLGSILHGWEEPKKDEPAPLIPTTHHRKEIFAQPLMVLD
DGRIAFWVGVPNGAVRVYDPKTRKCKEVVAMGKSCSMVGLYKGSQLGLAK
Download sequence
Identical sequences K4A290
Si032987m|PACid:19710893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]