SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033000m|PACid:19710068 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033000m|PACid:19710068
Domain Number 1 Region: 26-80
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000615
Family F-box domain 0.0058
Further Details:      
 
Domain Number 2 Region: 92-211
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00000876
Family Galactose oxidase, central domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si033000m|PACid:19710068
Sequence length 225
Sequence
MAAAPLVRDKDRATTLADPLDLENDGSGALPADVLYEILLRIPAKALCRLRLACRSWRMD
ASSSACTHGHVPSTGEYKVLHVGASIPPANRQPCQVITLVGSQRWKTRPDPSLPVSIYGH
TAVAGVVYFLLDDFSIRDFPDAKHDDIVAFDLATEEGHWTKRYTIPCPPHLNSPYSYPLV
ILDDGRIVLYFRVSRVLRAYDPRLGTWTDLTIRKDYFAVSLYEGT
Download sequence
Identical sequences K4A2A3
Si033000m|PACid:19710068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]