SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033014m|PACid:19710592 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033014m|PACid:19710592
Domain Number 1 Region: 18-76
Classification Level Classification E-value
Superfamily F-box domain 0.000000000144
Family F-box domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si033014m|PACid:19710592
Sequence length 463
Sequence
HKAPQPQDQGQEQTERDEPPAGPTSVHGLPDELLVRVLLHLGTSLHLVHAAATCRRWRRA
VADAGFLARFRSLHGVPSVAGHYYVTETLHPNSRDPWRRQVPEKMTATFVPVSPAVVDAS
HFSLDFLYVPPVDGNRPRYSYRSARRVRHSRSREIIDSRGSLLLLTNGISEGRYWSPDFI
VCEPLTRRCQGIARPSILSRLHFLGGFLLDGSGSGGCRDAMSNFRVLSVLYKQEGSFGTP
RACVFSPGSDGGWHFCWHPIMNDDDDDDDNDDDIELPTIDKIHLAGRAAGRIYWGIETGT
VLVLDESTLMFSVLTLPEQMRWPYRRTSFRVVGGVDGDMVRIVRLDGQDLVVYGQILGSG
QWVVEKSVRLRDTAAGLPGWRDSFSVQPARIVAAGDTFVVLTRTEKTWLFSVDLETMEAE
RRHERNRHAGPAYPCSLPWPPVLQAGLSQGDIVVRKRSQRRNG
Download sequence
Identical sequences K4A2B7
Si033014m|PACid:19710592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]