SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033021m|PACid:19712361 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033021m|PACid:19712361
Domain Number 1 Region: 4-58,91-108
Classification Level Classification E-value
Superfamily F-box domain 0.00000000196
Family F-box domain 0.0098
Further Details:      
 
Weak hits

Sequence:  Si033021m|PACid:19712361
Domain Number - Region: 116-222
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000445
Family Galactose oxidase, central domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si033021m|PACid:19712361
Sequence length 316
Sequence
MAPPPLPELMEELIEEILLRLPPSDPASLVRAALVSAPWCRIVSGAAFRRRFRAFHGTAP
LLGFLCDPMMVQHDLWDFVLVPTSSAFRPREPFAWRRPLDARHGRVLFQECSMYYRLHVW
DPITDAWITLPEMLDDYPDIDCWTAAVLCAAAATGECDHLDCHDEPFTVVVVGSDQNEEE
MFSYVYSSESGRWSEPTYALMTTEGGRRLGFVRLEDTRLCLWSRDDEADVGWAPNRVIEL
EKLLPFDRSLAWRTFLLGFAEGVGVIFLCVGDGVFTVDLKSSKVMKVYEGRISSVVPYMS
FRTPGTDLGTMTIFFK
Download sequence
Identical sequences K4A2C4
Si033021m|PACid:19712361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]