SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033029m|PACid:19711685 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033029m|PACid:19711685
Domain Number 1 Region: 14-71
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000144
Family F-box domain 0.0068
Further Details:      
 
Weak hits

Sequence:  Si033029m|PACid:19711685
Domain Number - Region: 161-255
Classification Level Classification E-value
Superfamily Kelch motif 0.00745
Family Kelch motif 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si033029m|PACid:19711685
Sequence length 372
Sequence
MAAPLPRSPPALMDELVEEILLRVPPDDPARLVHAALTCKRWCRLVSDPGFRRRFRLFHR
AGPMLGFVYRGTCTTGFTPTSSFRPPGAAVCRDWWPLDARHGRILFRDAVLIQAGKDIGL
IVLDPIAGEVRRLPLPWFTRSYRSWNAALLCAAAGCDHLDCAPGGPFIVIFVGTDAATGF
TSVLVYSSEAAKWRLTALIEGTSYDMIHGGSTLVGNALYYQEQIRGILEYDLGKKKLSFI
KLPPKYCRRPSMIVLMAAKGGVGLGFATLEDFDLYMWSRDESVPSGWTQQRVIKLRSLLN
APALSFSRYMMIALADGVGVVFILARDLGVFAVGLESGQVRKVSDDGDRIIDVFPYVSFC
TPGSCLMCLIHL
Download sequence
Identical sequences K4A2D2
Si033029m|PACid:19711685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]