SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033044m|PACid:19711121 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si033044m|PACid:19711121
Domain Number - Region: 27-72
Classification Level Classification E-value
Superfamily F-box domain 0.000133
Family F-box domain 0.01
Further Details:      
 
Domain Number - Region: 167-281
Classification Level Classification E-value
Superfamily RNI-like 0.0384
Family Cyclin A/CDK2-associated p19, Skp2 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si033044m|PACid:19711121
Sequence length 404
Sequence
AAAAAAAESPPRAGSYISSTGAGALEDRLSALPDDVLILLRLDTTAEATRTSVLSHRWRG
VWTLLPELHFHLATNGHRIREVLLTPDAPPPLLCISVIVADSAPDSLGAWIPEAARRLSG
DLGYYNMFPGMEEEEEEAGERGAVQLPCFENATGINLNLGFLGLALPFSGTFARLIKLTL
HRVRLHGPDELGDVVSSQRCPRLQKLSVRHAFGVDKLIIHSESLLQVDLWRLEGLRQLTV
NKNQPVANISAPQLVLLEWRDSYDPSSVQLGSLGQLQRLKTNFFRVYCEHDSGDNRGVLK
LLQQFRFILILNITLLYLQVSFSSLITRHCNVPYSMEDITMLPHTMFLTMEIMNKGHSFG
PSTFHMLRLCTDIRRLSLVLHTSRGLESSCQSGCNCDQPTNWKT
Download sequence
Identical sequences K4A2E7
Si033044m|PACid:19711121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]