SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033057m|PACid:19709401 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033057m|PACid:19709401
Domain Number 1 Region: 12-75
Classification Level Classification E-value
Superfamily F-box domain 0.000000148
Family F-box domain 0.0086
Further Details:      
 
Weak hits

Sequence:  Si033057m|PACid:19709401
Domain Number - Region: 138-213
Classification Level Classification E-value
Superfamily Sialidases 0.0942
Family Sialidases (neuraminidases) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si033057m|PACid:19709401
Sequence length 399
Sequence
MDPPPLRPPLMEELVEEVLLRVSPDDPATLVRAAVGCKRWCRLISGATFRRRFRELHPAA
PMLGFLYARRSGTDFVPASSFRPPHAFREDWNAIDARHGRVLVVALESFSPTGTRFIVWD
PVTDGAQSLPILEFRPYSWGDAVLCATAGCDHLDRRGGPFLVVVVVTDVSQMRTSAYEYS
SDQGTWSEPITVQHPNDWIMIRLHAHVGNALYFNYGLMILKYELGKRELAFIDLPSEFHA
RHMVLMQAEDGGLGFATIQESKLSLWSREAGADGYAGWAQQRVIDLDKLLPVSDCNISVS
PYVYAARPPYVVAVADNVGVIFIGKDDGLFTVHLNSGRAERIVVESNSNFKVVPYKPTRI
SCAAPTALLFYVLELDKCLHLVMYTFALILLHYLCSPVP
Download sequence
Identical sequences K4A2F9
Si033057m|PACid:19709401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]