SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033058m|PACid:19709946 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033058m|PACid:19709946
Domain Number 1 Region: 30-116
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000144
Family F-box domain 0.0058
Further Details:      
 
Domain Number 2 Region: 182-296
Classification Level Classification E-value
Superfamily RNI-like 0.00000745
Family Cyclin A/CDK2-associated p19, Skp2 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si033058m|PACid:19709946
Sequence length 496
Sequence
MYADGGACEECRYNQLASPCCRAGLLRRSPRVRRGTSGEDRISALPDDLRLKIISHLDCV
RAAANMSLLSRKWNGLWRHLPKLVFHNITPDPLIAALGQVPHPAGSSLNIYLQIHHKLSA
ERISSILRAAAPIEPANLHAVFFMDEDADTSVPIELPIFDRATSIKLSFPPLETTLLPTG
DFTKVETLSLTFCNIDLCDLLPRCPKLRKLKISCEPLDSIKVHSDSLEELDVYTLSDVRV
IDIATPKLKKLRFASNEGTEDAFSLSFSAPLLDDLLWQWWCKSSFGALWRMWTLKLKTIE
PHGRTHLASNGESSCLKLHQRPHNNILLLKMGRSRYARNVFRSFGLDISRIPVRFSILEL
DITTGRHVYGAVVLEVLGFCTSIQRLKIMLNRRQERKRRGTCRASCPCDRPRNWRSQSIT
LTNLKEVEVEGFSGEDHEVDLLKVIFRSTTMLEGVTLKFSRNVSPECSVYKELPSILDAH
PSVKFNIYSCYHFQES
Download sequence
Identical sequences K4A2G0
Si033058m|PACid:19709946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]