SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033070m|PACid:19711356 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033070m|PACid:19711356
Domain Number 1 Region: 187-287
Classification Level Classification E-value
Superfamily RNI-like 0.000000604
Family Cyclin A/CDK2-associated p19, Skp2 0.065
Further Details:      
 
Domain Number 2 Region: 31-91
Classification Level Classification E-value
Superfamily F-box domain 0.0000105
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si033070m|PACid:19711356
Sequence length 503
Sequence
MAAAGSCEKCREDQVSAPCCRWGLLRRSRRLRRSADDGEEDRISGLPDDVLRLFLVGLGC
ARGAAHTGLVSRRWRNLWTGLPELTFHNTAPDQIEAALAQVTRTSMFLLDIDVARHHPLE
PPAVTSLLRSAARLAPAELKAVFSGATQYRSNPSYHVDVELPCFDRTTSISITMFIPAVN
LVMPPAGDFLKLESLSLRSCDVSVDSLLPRCPRLRKLCIQRTRILSITGHSPSLEELDVT
THGVLLRVDIEAPLLKKLSIYAVVGISNEFSISYSAPKLEELSWMCGHNSKSGVGLGIWR
MSSLTLETRKLLGDKQLADDKESTCLQPQHCPRVDTAHYKDATRSFRQHMSQLPVANFSI
LELDILTRGHAYGGVVLDLLMICSTVQSLKMKLREVGPRVEECLVDCTCDHPNNWRSQTV
PMTDLKEVEIQGFKGEAQEIDMLKLIFRSAIMLERVTIEFYSKVSPRDNRYMETLGILKA
HPSVESTVFLRKRVLKFEGMVID
Download sequence
Identical sequences K4A2H2
Si033070m|PACid:19711356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]