SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033081m|PACid:19711278 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033081m|PACid:19711278
Domain Number 1 Region: 116-338
Classification Level Classification E-value
Superfamily RNI-like 0.00000000968
Family Cyclin A/CDK2-associated p19, Skp2 0.051
Further Details:      
 
Domain Number 2 Region: 22-76
Classification Level Classification E-value
Superfamily F-box domain 0.000000012
Family F-box domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si033081m|PACid:19711278
Sequence length 453
Sequence
MSTVPASPIGDAAGGGCDGEYPDLISLLPDCILTTILSLLHLPAAARTQILSRRWRRLWA
SAPLHLLDSHIPVPTSSLSAAVSRILASHIGNAARFHLLLARPSAADHDSWLRSLAAKHL
QELVLRPPSDEPLRLPPSLLSCRSLRSAELTNCSLPEDAVGGEVCFPHLAELTLRLSRVP
SAAALHGLLAGGPELASLSLDRVFGCRTLRVRSGSLRSLTVSVSLTRRRVLEEADELEHL
VVEDAPALERLLAHDINWGPSINVVHAPRLQMLGYLGVGILELQLGSALFRSMCAVRLAA
EFRCVRVLALEMADPQLKPVADFLRCFPCLETLYVTSHMVIPQSMKILNYEMTDPIECLN
DHLKTVVLKGYRGRKHELQLAMFLVRSARVLQVIKFLCENDCKPSWLANQKRQLLLDNRA
SLGAQFVFQKFTKSYIRFLKQARNISLVDPFDT
Download sequence
Identical sequences K4A2I3
XP_004955964.1.39314 Si033081m|PACid:19711278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]