SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033118m|PACid:19709645 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033118m|PACid:19709645
Domain Number 1 Region: 13-67,150-172,296-314
Classification Level Classification E-value
Superfamily F-box domain 1.7e-17
Family F-box domain 0.0047
Further Details:      
 
Domain Number 2 Region: 71-145,338-381
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000298
Family Quinoprotein alcohol dehydrogenase-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si033118m|PACid:19709645
Sequence length 399
Sequence
MGPVLRRRKKTALALDNDGVLPADVLYEVLLRLPADELCRLRLVCRSWRSLTSDPGFARA
HASRHPLLAGVHIACCTDDEIRVVDLFSGDIVRRIVPTVQPRYGMNSQLDLVCVSGRRTH
EPSSVLNLATGEVVATFHPKSHWINKDMMSPFLLGHIPSTGELKVFYTHWCGEGGGHGGF
VQKCCIKTLIGDGSSRRWRVTSSPLAVLGSDLRDRVVIGGVAYILFSQNFNETNDHNEDL
EPDDMAVFDMAAEEWRPAPLRGPLSSCLAGDDERCVHHQHRHEILLAMVDDCLVTVHNND
CYQYCSMDLWFLVDMDVDKGLWTKRFSIHCTTLCKGFKCHSPYPLLLLDDGRIVIWEDVI
KVLRVYDPRTSKWDDITTLENYFSVNMYRGNLLCPGLQR
Download sequence
Identical sequences K4A2L9
Si033118m|PACid:19709645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]