SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033122m|PACid:19711447 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033122m|PACid:19711447
Domain Number 1 Region: 4-57,90-120
Classification Level Classification E-value
Superfamily F-box domain 2.62e-17
Family F-box domain 0.0046
Further Details:      
 
Domain Number 2 Region: 132-367
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00000458
Family Galactose oxidase, central domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si033122m|PACid:19711447
Sequence length 386
Sequence
MEQGTTPATYLPDELVVEILARLPAKSLCRFKCVSHRWRRLISDPAHRARFVQTLSGFFF
LSDEGPRFRFTALPSSVTPLEEDGDGPPLVDAALSFLPPRCGEIEMLDSCNGLLLLRCYN
ELSSSPPPPFYVVCNPATREWVALPQPRYNGYGQGARTWYAAVGFDPAISSHFYVFQVVE
VHDAMPLLPIAAVEVYSSETGTWVLRECKPEWIYFYGRMTYFNGSLHLPIEHEKVVSVDP
NGQSWKVTQVRHCEDHGRREGRGYVGHSQGRLIYANNDRKYDVLSIYVREDQASREWIMK
HNVSKSDLLFEPWKHMLKPTYYIAGFHPDGDLVFFYDRTRNMLISYDMNHGDWHVVCTLE
DFRHAHHPFFPYVPWYSRGLASPNIN
Download sequence
Identical sequences K4A2M2
Si033122m|PACid:19711447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]