SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033143m|PACid:19709700 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033143m|PACid:19709700
Domain Number 1 Region: 76-210,258-301
Classification Level Classification E-value
Superfamily RNI-like 0.0000471
Family Rna1p (RanGAP1), N-terminal domain 0.076
Further Details:      
 
Weak hits

Sequence:  Si033143m|PACid:19709700
Domain Number - Region: 23-66
Classification Level Classification E-value
Superfamily F-box domain 0.000262
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si033143m|PACid:19709700
Sequence length 334
Sequence
MGTIAGDKWKSRLEEEEDEELVDRISGLPDAVLGDIVTLLPTRDGARTQVLSSRCVRVSA
SEITWILSAHRGPGHRSCTELQHLDLHDDSRPATVLDGWLRSPALHNLEQLEFHYGYRFP
LGFSPLPPPPQLPASVQRFSSTLRIAKLAGCSFPEGNAGTLHLPSLLLSYNSGYSRVRIV
SRTLLSIGVNPGRGDSRLQHLILEDAPCLERLLIFPYAYGYAKIMNISVISAPKLNILGP
LCDDLSTVEFGTTVFQGPRLVSFMTVAPSVKILALLNMQISLDVVINFMKCFPCLEKLYI
KTVLARCKNRRSREYQNFVRTRDIRLKKVVLLNY
Download sequence
Identical sequences K4A2P2
Si033143m|PACid:19709700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]