SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033167m|PACid:19711342 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033167m|PACid:19711342
Domain Number 1 Region: 7-60
Classification Level Classification E-value
Superfamily F-box domain 0.0000000107
Family F-box domain 0.0098
Further Details:      
 
Weak hits

Sequence:  Si033167m|PACid:19711342
Domain Number - Region: 46-151
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00131
Family Galactose oxidase, central domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si033167m|PACid:19711342
Sequence length 166
Sequence
MAKLVEETILLRVPPDNPACLTRASLVSKPWCRLLSDPTFGRCYCTFHRAPPCSASFTIT
YARLMIVPVGAYSTDAMGGNLVVWDPTTGKQQRLPEPPVELGAYNAAVLCAVRGCDHLDC
RGDPFFVILVGYNQVLWLHLYSSEAGAWIASSHLVKFELQVFGIIE
Download sequence
Identical sequences K4A2R5
Si033167m|PACid:19711342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]