SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033176m|PACid:19710047 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033176m|PACid:19710047
Domain Number 1 Region: 20-72
Classification Level Classification E-value
Superfamily F-box domain 0.0000000392
Family F-box domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si033176m|PACid:19710047
Sequence length 438
Sequence
MEKERARHSKEQMPATKLPTTVNDVPNHLLKLIFGRLDSHVSFLRAAAVCTRWRHIASSH
GMRYRDCNYHDFSTTIGHYHVVDPSFSPEPRSSQAQRRHRVVFIPALPSIDVRHFTLDFL
PSGPGSRPWQLVDGYGSLLLLTNQRHSSFPDIVVCEPISRRYFKIKPIKDMKYCHCLGVF
LNRRYNVSSMSSFTLTCMVYQRSTGIADGVSYVTAHVYTHGPPWSRRWRHGWSTSRHAMS
GGIHIRGAESVHYAGRSKGSIFWGIEDDGSVFSGEEGTGVLSHFHLPENVRGSQHRSTFR
FIDDGVDNLVRVISLIGKDLRVFLKKEHNNGGSDWVLVRSLHLPEATLGFPGYKECFFSH
TAKIVTAGKGYVVLTPVEETWLFSVELGTMQVERDHIRNKLAGEVYPHELWLQPKVSACV
LRCKRGRDGPCYDMCKCK
Download sequence
Identical sequences K4A2S4
Si033176m|PACid:19710047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]