SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033177m|PACid:19710758 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033177m|PACid:19710758
Domain Number 1 Region: 162-360
Classification Level Classification E-value
Superfamily RNI-like 0.0000000157
Family Cyclin A/CDK2-associated p19, Skp2 0.042
Further Details:      
 
Domain Number 2 Region: 17-71
Classification Level Classification E-value
Superfamily F-box domain 0.0000196
Family F-box domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si033177m|PACid:19710758
Sequence length 474
Sequence
MAPPATQRRRGSHKKAPVAAEVPPEAPVADIRALPDEVQSAIISLLPTDAGVRTRAVASG
WTALWRAAPLNLDDRELRLRPSWRNGDRIAARITSILSAHPGPARRLSLMNLTRVSNTTG
DDRYATFDAWFRSPVLNRVKEVHFQYLYRYRADELDPLPLPALRFTDLTIASYGRCHFPD
NLAGVRFPNLTQLTLHDLTNTERTVHDMISACPQIRSLLLRNNKRFRRVRISSPTLISLG
LSVGEHDDEPAMEQLTIVDAPSMERLLIFDTEGGPINIRVIGAPNLRVLGSLPSSLLRLQ
LGNTVLQEMIAINAITSMHSVKILALGADGFKLDIIVDILRCFPCLEKLYFTSMVIESGE
TMQNNGALLPIQCLETHLKEIVLRNFTGTREDVRFAKFFILNSRVLELMEFRAPVRQNIK
KWEANERRKLPRKSDRASQAARFRFVYHTCLFRNYEDTNRTHALTESDPFKGML
Download sequence
Identical sequences K4A2S5
Si033177m|PACid:19710758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]