SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033184m|PACid:19709137 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si033184m|PACid:19709137
Domain Number 1 Region: 15-103
Classification Level Classification E-value
Superfamily F-box domain 0.0000000017
Family F-box domain 0.0057
Further Details:      
 
Domain Number 2 Region: 168-377
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0000051
Family DPP6 N-terminal domain-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si033184m|PACid:19709137
Sequence length 384
Sequence
MDCPKTKGIEAAVACLPDDALEGILSRLRAKPLFRFNCVSKAWCGLIADRLRCRKFPQNL
EGFFIGGRGENFGDFIDLSGRPVPLVDPSFSFLTNSQEIAKIVLLGSCNGLVLFGHRRVS
DNYDTLGYIVCNPATEQWVTVPSSGWTPWEDSEDEENQDDVQAERLDTYLIFDPAVSPHF
QLVQLLSLDLYDLEEVHTFSSVTGAWRQHEGIHGQAWKQWGSMAMAISVACAFNGMLHMS
IHFHDSNLNMIVAVDGEGEPFKTMHWPDDSGRVVFFVGQSQGHLHCMSVHTGDLVQMTQL
SIWVLEDYDAEKWLFGRMRCHYLDYDVVAIHPYRGLVFFVEKWNWRLISYDMDTKEVHAL
CTLGHDYHRKNPVCPLFRRGSGAR
Download sequence
Identical sequences K4A2T2
Si033184m|PACid:19709137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]