SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Si033257m|PACid:19711008 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Si033257m|PACid:19711008
Domain Number - Region: 128-269
Classification Level Classification E-value
Superfamily L domain-like 0.000173
Family Polygalacturonase inhibiting protein PGIP 0.066
Further Details:      
 
Domain Number - Region: 3-39
Classification Level Classification E-value
Superfamily F-box domain 0.00981
Family F-box domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si033257m|PACid:19711008
Sequence length 452
Sequence
MQDIMYHIHSLLPLRDAARPAFVSHVFLNSWRCRPNLCLSMKALGFKASSYGNDKASRDF
TKIVDHILKKHSGFGLKTFRLAMYGCHNVNACHLDSWLHLALILGVEQLILEFPSMIRYN
FPFFCTFRPTVRLGCFRSLKKLHLYYVSITGDELGCLLPNSVALEQLELRYCKDIICLKI
PRVLLRLSCLKVFACDNLREIMSEAPNLSSLCFEWFDRHVTISLGEALHVKKLEIPCFRS
FNYAQLPTIVPNLEIRDSITVSIDHKPPQLNTSEVPIPGETHGPAYDYLSVSSFLGASPC
LETFILRIHVSISHLAKIYSVYLVMDSSIFAWFSIFRYRKPAWSTACLPEIPRFCVGCQN
TVMRSSSVCRSPASTLQRAFWNLELACYVLETATSLERLELGTTYCPYWFTKSKHASCYL
VAIRTYIEGKVPSTVRLDVQGPWTRTGGSANS
Download sequence
Identical sequences K4A305
Si033257m|PACid:19711008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]